HORDB

ID: hor006789
Uniprot ID: A0A0A7DP6
Protein name: Prepro-gonadotropin-releasing hormone-like protein
Gene name: NA
Organism: Ruditapes philippinarum
Family: NA
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Spiralia; Lophotrochozoa; Mollusca; Bivalvia; Autobranchia; Heteroconchia; Euheterodonta; Imparidentia; Venerida; Veneroidea; Veneridae (venus clams); Ruditapes; Ruditapes philippinarum (Japanese littleneck clam) (Venerupis philippinarum)
GO MF: GO:0005576 extracellular region
GO BP: GO:0005179 hormone activity
GO CC: GO:0007218 neuropeptide signaling pathway

Sequence: SYHFSNGWNPGKRSMQEPVCHFRQDVQTLVLKLIEDEVYRMLSDPSCIGGVPTLRNFLKKDLAYTVPLDDKK
Length: 72
Propeptide: MNACILLTTLVTMITIEKVQGQSYHFSNGWNPGKRSMQEPVCHFRQDVQTLVLKLIEDEVYRMLSDPSCIGGVPTLRNFLKKDLAYTVPLDDKK
Signal peptide: MNACILLTTLVTMITIEKVQG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Positive significant correlations between rp-GnRH expression and progesterone content as well as between rp-GnRH expression and testosterone content were observed throughout the gonadal maturation.
Mechanism: Positive significant correlations between rp-GnRH expression and progesterone content as well as between rp-GnRH expression and testosterone content were observed throughout the gonadal maturation.
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

Mass:		Formula:
Absent amino acids:		Common amino acids:
pI:		Basic residues:
Polar residues:		Hydrophobic residues:
Hydrophobicity:		Boman Index:
Half-Life:		Half-Life Yeast:
Half-Life E.Coli:		Aliphatic Index
Instability Index:		Extinction Coefficient cystines:
Absorbance 280nm: